tag:blogger.com,1999:blog-17256618Tue, 25 Jan 2022 09:00:31 +0000neki desuweavingvidslife in generaljapanophiliamachine knittingstitchingsurface designsewingaizomenatural dyeingdyeingshiboritextilesanimationsilkfashionlinentoolsTASTresourcesfoodnatural dyesdesignTIFcreative resourcesfriendsgardeningnihongonaturekakishibuzomemusicgeekeryphotographyknitting machinestampingdbjhacksmurasakizomenew hoodtravelsweaving toolsdigital printingembroiderylampasyarnssamplesakanezomeinspirationpattern draftingvintagedigital designloom controlled shiboriBarcelonaartbook artsfood recipesfractalsknittingliteraturegardening in the citytutorialbrazilwoodcomposition coursephotofunbloggingcolorcraft theorypomegranatesculturefabrichanamiitajimewalnut hullswineATCcraftsculturetadigital artindigo dyeingcorona confinementembroidery chartsglitch artneedle feltingneedlefeltingprintingtaberutextile designurban gardenMadridbengarabenibanacarrot topscomputer generated imagesdigital treatmentfrivolitésinternetnekidesurecipeswirecatalunyadeconstructed screen printingfairy godmotherlacelutradurpapermakingpatinasectional warpingspainwoolbalenciagalichensmachine stitchingscreen printingyarns and threadsPrint Goccocherry barkcochinealcollapseel caminoelectronicsflour resistgromwellheat treatedindigolace seriesnew studioouvrages de damespigmentsrust dyeingATC exghangeDAKarduinoartfire jewelrycard punchingcompositioncotton yarnecommercehistoryimage knittingjacquard loomskanokokasurikyotomaddermixed mediamonofilamentrichard sennetrustsakurashifusuppliestriple weavevalenciawarpingweaving resourcesyardage2 color knittingRay Daviesabstract expressionismarchitectureasturiasautodenterbudlejacyberiadevorediydouble weavedyesfeltinghelsinkiikatimage transferinvisiblesitjimeloom hacksmokume shiborimushroomsneedle feltneedle worknettlenew materialsonion skinspatchworkreadssandra rudetextiles sustainabilitythree layerswashiBaliCatalan flagFirefoxFlores islandGuimaraes BiennialHaitiJoselito hamMokuba ribbonsNiepoort portPeter CollingwoodSardegnaTIF drawingTengananThe Kinksa day in the life of loomsaizome itajimeannouncementsartfireawardsbashofubingatablind contour drawingburgoschestnut dyecinemagraphcling filmcloud filling sitchcomedycut and sewcutworkdavid hockneydischargeeducationenvironmentetsyeucalyptusexchangeexperimentsfoilinggranite weaveshamhealthhymenocallisimg2trackkiasmaknotted buttonhole stitchknotted loop stitchkumihimoleon.architecturelodz triennialloomsdaymariano fortunymodern pattern designmonetnarukosnature.lampasneedlefeltneki deusnetwork-draftingonline opportunitiesopen sourceoperapibionepiecingportoresist tutorialresources.restoration projectreversed bororibberrope stitchrovaniemisafflowersiennese stitchsizingslow clothsnowsorbellostitching friendstanabatatarragonatraditionsufosup and down fly stitchvids. portugalwave stitchwebsitewing needleyosakoia movable feastMost of the time life IS a constant celebration, yet it keeps changinghttps://amovablefeast.blogspot.com/noreply@blogger.com (neki desu)Blogger2238125tag:blogger.com,1999:blog-17256618.post-6239928882527166097Tue, 25 Jan 2022 09:00:00 +00002022-01-25T10:00:00.234+01:00neki desusewingthis baby<div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEgOPQ2LjjDMp5ViKLITGQGuE9hmt5iyhwDSumxb_JIHBc-mV0zzi4SzB8qq-AtuQePM0BVAxJDHa_ee7pnwx9o6ePwxTdyblYJQ8MV073_rxV_Bz_raGKiwFAfyO7QGE4-ey9T1Gu7Wdu6VOp5eeJDimV7jkKhbvL_3dfa5M3e75ASJsTloUA=s700" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="526" data-original-width="700" height="480" src="https://blogger.googleusercontent.com/img/a/AVvXsEgOPQ2LjjDMp5ViKLITGQGuE9hmt5iyhwDSumxb_JIHBc-mV0zzi4SzB8qq-AtuQePM0BVAxJDHa_ee7pnwx9o6ePwxTdyblYJQ8MV073_rxV_Bz_raGKiwFAfyO7QGE4-ey9T1Gu7Wdu6VOp5eeJDimV7jkKhbvL_3dfa5M3e75ASJsTloUA=w640-h480" width="640" /></a></div><br /></div><div><br /></div><div>is going to turn into a pair of beautiful pants.&nbsp; the pattern finished.&nbsp;</div><div>the fabric is beyond awesome , a wool knit lined with a light cotton knit so that it's not scratchy on the body.</div><div>inevitably i&nbsp; go short on fabric&nbsp; when i buy so i can't make the japanese&nbsp; jacket&nbsp; pattern to go with the pants.</div><div>too little for the jacket too much as a remnant. thinking about making a dress. the skirt will be the remnant the bodice knitted.</div><div>it is an exercise in irony sewing all these clothes with a pandemic and its corresponding lockdowns going on.</div><div><br /></div><div>neki desu&nbsp;</div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2022/01/this-baby.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-5511704994044100522Mon, 24 Jan 2022 09:00:00 +00002022-01-24T10:00:00.234+01:00compositionneki desulast week's work<div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEiDrFKfAYWTOuyECSU38gjbIdw9iUUKjBOTBtlV9evvzo0kwuCR1gb85uaUaSaaDn-dS4C5SkIzTFmHWkRQLvcRQ1Ub4fTOopnD9egIMLU5XW82CrvoFeUpyeppRVoKbFb2yIu6KfLEWlCSoZUW5x9DCmLZA8xgF2e-1_7ikuVB5cr4CFdvbQ=s700" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="526" data-original-width="700" height="480" src="https://blogger.googleusercontent.com/img/a/AVvXsEiDrFKfAYWTOuyECSU38gjbIdw9iUUKjBOTBtlV9evvzo0kwuCR1gb85uaUaSaaDn-dS4C5SkIzTFmHWkRQLvcRQ1Ub4fTOopnD9egIMLU5XW82CrvoFeUpyeppRVoKbFb2yIu6KfLEWlCSoZUW5x9DCmLZA8xgF2e-1_7ikuVB5cr4CFdvbQ=w640-h480" width="640" /></a></div><br /></div><div>this is proving to be a good exercise.it forces me to look and think as well as letting myself go. not to mention the discipline of taking a piece of paper every day and working it.</div><div>collaging some paper bits on this one.collage has never been my thing don't know why as weaving textures also hasn't. maybe it is bcse it's too evident and becomes easy.</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><div class="separator" style="clear: both; text-align: left;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEgr_I442mwx2qro6m-SGmuUwI5HpuQWVIVYGQa_DQdHcaTojLigRvAzJ0q7Gk_5tjjZUqIzEFkUVk_iR0aqHM7HTABDyqoZO48zwzgrRH2ap2blgO8L9YojcIXFsOBI1NmYl9-eVcBq5rPKrQJgjQst3Vzmfku4DBJpVwz8v6RbFoxj_wUY6g=s700" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="670" data-original-width="700" height="383" src="https://blogger.googleusercontent.com/img/a/AVvXsEgr_I442mwx2qro6m-SGmuUwI5HpuQWVIVYGQa_DQdHcaTojLigRvAzJ0q7Gk_5tjjZUqIzEFkUVk_iR0aqHM7HTABDyqoZO48zwzgrRH2ap2blgO8L9YojcIXFsOBI1NmYl9-eVcBq5rPKrQJgjQst3Vzmfku4DBJpVwz8v6RbFoxj_wUY6g=w400-h383" width="400" /></a></div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEjrf3yVlq_GohWHHsFuxfFjW6KDtdjZcptCzsGwuRAvOXoVAYcydgtG1HSJO2-aiaHiyorzIa7VYkq4QT66xLafk83r_L66qRKqtu8xptH_RFSH4uoJPjNSHDKnogoMc9R9Bj9NbuatlAi2QGA3eIGtmkWzAIzDiJHDvQgRQ6W0Sr0qdwoLZg=s759" style="clear: right; float: right; margin-bottom: 1em; margin-left: 1em;"><img border="0" data-original-height="759" data-original-width="700" height="400" src="https://blogger.googleusercontent.com/img/a/AVvXsEjrf3yVlq_GohWHHsFuxfFjW6KDtdjZcptCzsGwuRAvOXoVAYcydgtG1HSJO2-aiaHiyorzIa7VYkq4QT66xLafk83r_L66qRKqtu8xptH_RFSH4uoJPjNSHDKnogoMc9R9Bj9NbuatlAi2QGA3eIGtmkWzAIzDiJHDvQgRQ6W0Sr0qdwoLZg=w369-h400" width="369" /></a></div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><br /><br /><br /><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEhZnxrqFTjKHOSXZ5eqCjwRzjZEZUDK1_hneLaupV7ruuSHRhwRG4_Q0I3INil1le-BL1pcLhokCOFWbvbh9HjfZlh4wEC368Xxgd-pK2e86FkSXfl8wTZR_sGQlVG1Wz4sCp476UBV3QCRoITFUHywlFdnc-gyEX91-nzo2eTYXem2co1xxg=s700" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img border="0" data-original-height="696" data-original-width="700" height="398" src="https://blogger.googleusercontent.com/img/a/AVvXsEhZnxrqFTjKHOSXZ5eqCjwRzjZEZUDK1_hneLaupV7ruuSHRhwRG4_Q0I3INil1le-BL1pcLhokCOFWbvbh9HjfZlh4wEC368Xxgd-pK2e86FkSXfl8wTZR_sGQlVG1Wz4sCp476UBV3QCRoITFUHywlFdnc-gyEX91-nzo2eTYXem2co1xxg=w400-h398" width="400" /></a></div><br /><br /><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>pleased with the ink washes and the fine line in this one.</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>neki desu<div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2022/01/last-weeks-work.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-858574226697659259Fri, 21 Jan 2022 09:00:00 +00002022-01-21T10:00:00.225+01:00japanophilianeki desuvidssensoji wonderland <iframe allow="accelerometer; autoplay; clipboard-write; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="480" src="https://www.youtube.com/embed/5kS0LwxtJGc?controls=0" title="YouTube video player" width="640"></iframe> <div><br /></div><div>best loved tokyo temple in the snow. bonus sutras.</div><div>have a good weekend.</div><div><br /></div><div><br /></div><div><br /></div>neki desu<div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2022/01/sensoji-wonderland.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-4940531128676270342Thu, 20 Jan 2022 09:00:00 +00002022-01-20T10:00:00.209+01:00neki desupattern draftingsewinga little detour<div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEhsDjnIlNLt4MXFzus1AxZrel5IpvtEr41GTThc-iPJ2DDK3X0mnYztFPNcDjTnuq7Vihtw1lTQKYEtNDenymAJtWhjx1Dt7dAtLA0jEhN3MdNfvnax1b3Yb1ARSoPCszdc-MSQrDPrZSujGKZyF69IvEyZadMawqmaqnfAGIe3Cl-j7BNB1A=s932" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="932" data-original-width="700" height="400" src="https://blogger.googleusercontent.com/img/a/AVvXsEhsDjnIlNLt4MXFzus1AxZrel5IpvtEr41GTThc-iPJ2DDK3X0mnYztFPNcDjTnuq7Vihtw1lTQKYEtNDenymAJtWhjx1Dt7dAtLA0jEhN3MdNfvnax1b3Yb1ARSoPCszdc-MSQrDPrZSujGKZyF69IvEyZadMawqmaqnfAGIe3Cl-j7BNB1A=w300-h400" width="300" /></a></div><br /></div><div>they look enormous but they're size 42 eu which is average size. found them in the proverbial drawer&nbsp; and why not draft the pattern?</div><div>so here i am in such an elegant procrastination mood instead of sewing the pants with the pattern i have.</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>neki desu</div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2022/01/a-little-detour.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-2953656446390388008Tue, 18 Jan 2022 09:00:00 +00002022-01-18T10:00:00.221+01:00compositionneki desunext<div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEg8h8hqL3N_Jw48VnrPbbNCCxJvs0gpG_o0Mu25pFMv87uVocpgWvVqoQW6a59mJMSGIEIoomfJdR9cnV-5XYm8lrZfDbA3aUKfkxu2UTcGf-Tg2BbLZl0_GjbfkZ43psFqEBbrp61hWypqnhWVP_vYnRKLSBCBDpT6DBJIw2E_dIe6kKOWSQ=s700" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="526" data-original-width="700" height="480" src="https://blogger.googleusercontent.com/img/a/AVvXsEg8h8hqL3N_Jw48VnrPbbNCCxJvs0gpG_o0Mu25pFMv87uVocpgWvVqoQW6a59mJMSGIEIoomfJdR9cnV-5XYm8lrZfDbA3aUKfkxu2UTcGf-Tg2BbLZl0_GjbfkZ43psFqEBbrp61hWypqnhWVP_vYnRKLSBCBDpT6DBJIw2E_dIe6kKOWSQ=w640-h480" width="640" /></a></div><br /></div><div><br /></div><div>some subtle visual textures .working on student grade calligraphy paper i bought in japan. not terribly resistant&nbsp; as i like to dilute acrylics with alcohol. i dont mind as these are exercises and not museum grade works.</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEjMUfC72f1oJky9nzRPkUFODclcdTcwK5rMQVrLvjWxWFmM1rY7XDSIEJr5Qt_SB47Zx7inuih4F8ur4lMjb8M3S_T5nE-2BhA5sXvsQazyb82Rmg2Agtm1PCSqdWyb_1LfnZX9ffBBVWdTBgLfcAfxy3ry-GYejcJQGbXL2EHUDqzbmP8xeg=s700" imageanchor="1" style="clear: right; float: right; margin-bottom: 1em; margin-left: 1em;"><img border="0" data-original-height="526" data-original-width="700" height="300" src="https://blogger.googleusercontent.com/img/a/AVvXsEjMUfC72f1oJky9nzRPkUFODclcdTcwK5rMQVrLvjWxWFmM1rY7XDSIEJr5Qt_SB47Zx7inuih4F8ur4lMjb8M3S_T5nE-2BhA5sXvsQazyb82Rmg2Agtm1PCSqdWyb_1LfnZX9ffBBVWdTBgLfcAfxy3ry-GYejcJQGbXL2EHUDqzbmP8xeg=w400-h300" width="400" /></a></div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div style="text-align: justify;"><br /></div><br /><div><span style="text-align: justify;">as exercises they're doing its job and&nbsp; firing possibilities. in all fields.some are more elegant solutions than others but that's ok.</span></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>neki desu<div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2022/01/next.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-7438176686811027454Mon, 17 Jan 2022 09:00:00 +00002022-01-17T10:00:00.239+01:00compositiondesignneki desucombatting frustration<div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEhK_kmE4-GHncu_EWjLUdMBMEJOejv3v28Cny_L8Ag73uBXSs5pQpqpa4JbXJUJfzAIAzI-dG6JoGgTtvXRDGgWByQ45EE9q3QmsClgWEhURHkpq_18pJarZj52HuJtZ2lqLuDS3IbtxpBxnSQUiJDYBDRM4mYvheH4aJPU7BPeEfxP5sL5cg=s700" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="662" data-original-width="700" height="606" src="https://blogger.googleusercontent.com/img/a/AVvXsEhK_kmE4-GHncu_EWjLUdMBMEJOejv3v28Cny_L8Ag73uBXSs5pQpqpa4JbXJUJfzAIAzI-dG6JoGgTtvXRDGgWByQ45EE9q3QmsClgWEhURHkpq_18pJarZj52HuJtZ2lqLuDS3IbtxpBxnSQUiJDYBDRM4mYvheH4aJPU7BPeEfxP5sL5cg=w640-h606" width="640" /></a></div><br /><div class="separator" style="clear: both; text-align: left;">the knitted top is parked because it was giving me a hard time. doing composition gymnastics to aid frustration. i am challenging myself to use this composition in just values of black and white. working daily&nbsp; intuitively, not worring much, with all possible variants or until i get bored.</div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEj3NZpuI3mVQvCEn4YwH47AGCODvyQEyYhAb3wWZVEYPrp5FyPySxqPY9Ovn56Oub3acJiVhfHBU36Gp471FJgemOIhSX5Jsg5GV0mOPWL7RrObiOI7XVsz4mJW8R1-cJSU2TkdFhs5t1RNbTnt6-Mgw9rK-_1gdPILHNtbNp_MaxhR8HsuAQ=s700" imageanchor="1" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img border="0" data-original-height="561" data-original-width="700" height="320" src="https://blogger.googleusercontent.com/img/a/AVvXsEj3NZpuI3mVQvCEn4YwH47AGCODvyQEyYhAb3wWZVEYPrp5FyPySxqPY9Ovn56Oub3acJiVhfHBU36Gp471FJgemOIhSX5Jsg5GV0mOPWL7RrObiOI7XVsz4mJW8R1-cJSU2TkdFhs5t1RNbTnt6-Mgw9rK-_1gdPILHNtbNp_MaxhR8HsuAQ=w400-h320" width="400" /></a></div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><br /><br /><br /><div><br /></div><div>neki desu&nbsp;</div><div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2022/01/combatting-frustration.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-2095055958658809860Fri, 14 Jan 2022 09:00:00 +00002022-01-14T10:00:00.236+01:00japanophilianeki desuvidswinetr wonderland<div style="text-align: center;"><iframe allow="accelerometer; autoplay; clipboard-write; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="315" src="https://www.youtube.com/embed/wqSj6ioOFM0" title="YouTube video player" width="560"></iframe></div><div><br /></div><div><br /></div><div>golden splendor. have a good weekend</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>neki desu&nbsp;</div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2022/01/winetr-wonderland.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-1282968558945518450Thu, 13 Jan 2022 09:00:00 +00002022-01-13T10:00:00.249+01:00DAKmachine knittingneki desuthis too<div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEh2YWjW8WM6guDVJGFZJxJWF5mN99paEjmn3J3sHu41qb5iXXXj1Wh5ndiLt9ZR3-FX3VqfhsYs5ZVUYScLkuAc95lrOjwfW_KCeALj7evI7TfL64k9U44Hu27o3kkoIfXEViF-NS-8O2xodo7tGh73lTAPi_Oxsz3lQ1Xrf_dy7idOj_UpJQ=s700" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="525" data-original-width="700" height="480" src="https://blogger.googleusercontent.com/img/a/AVvXsEh2YWjW8WM6guDVJGFZJxJWF5mN99paEjmn3J3sHu41qb5iXXXj1Wh5ndiLt9ZR3-FX3VqfhsYs5ZVUYScLkuAc95lrOjwfW_KCeALj7evI7TfL64k9U44Hu27o3kkoIfXEViF-NS-8O2xodo7tGh73lTAPi_Oxsz3lQ1Xrf_dy7idOj_UpJQ=w640-h480" width="640" /></a></div><br /></div><div><br /></div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEgNZbcXrzoTrWOqF438q3_lNH372dlUrT6LyzHhI49BbvTPoaiyAeYpnmM7xD8SXkRyV2OQW15iia4Ry5B6G_pesS7MkdBpf1Fhcdg0k7KGAgd7J7UfgCBAIUlUpOHNDv3NAFKCeMHi3rZmqTa51oa3J_lDAzhvhg2cNKYRjFMeUDzH2248kQ=s674" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img border="0" data-original-height="674" data-original-width="610" height="320" src="https://blogger.googleusercontent.com/img/a/AVvXsEgNZbcXrzoTrWOqF438q3_lNH372dlUrT6LyzHhI49BbvTPoaiyAeYpnmM7xD8SXkRyV2OQW15iia4Ry5B6G_pesS7MkdBpf1Fhcdg0k7KGAgd7J7UfgCBAIUlUpOHNDv3NAFKCeMHi3rZmqTa51oa3J_lDAzhvhg2cNKYRjFMeUDzH2248kQ=s320" width="290" /></a></div><br /><div><br /></div><div><br /></div><div><br /></div><div>which is ,front and back,this joined at shoulders sides open and 10cms rib at the hemline.all designed in DAK.</div><div>( the shoulder lines are identical, it's a pixel glitch)</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEhahkjW07Jy2uZZlv76w4fZUr9FcPjDqIrTnGi_VM5qIFum1e-6p6eeidDpKehi8SfQuvESXwuIpeWS4ri8M6TzhRKC7kyF0llq3GJX43AQr7tmM_VzJdxM2yXnxCYIT7mnC4eAtnv5j2HHBlObmj_Iup2ZtfOkgfH-hj6Ek74a9yxH7bjUig=s700" style="clear: right; float: right; margin-bottom: 1em; margin-left: 1em;"><img border="0" data-original-height="525" data-original-width="700" height="240" src="https://blogger.googleusercontent.com/img/a/AVvXsEhahkjW07Jy2uZZlv76w4fZUr9FcPjDqIrTnGi_VM5qIFum1e-6p6eeidDpKehi8SfQuvESXwuIpeWS4ri8M6TzhRKC7kyF0llq3GJX43AQr7tmM_VzJdxM2yXnxCYIT7mnC4eAtnv5j2HHBlObmj_Iup2ZtfOkgfH-hj6Ek74a9yxH7bjUig=s320" width="320" /></a></div><div>sure, knit and then knit the rib separate.</div><div>&nbsp;after many tries that was never going to work.</div><div>the other option i could think of was to pick up the stitches to the main bed and then transfer <b>eos </b>to the ribber and knit.</div><div>doable but a pain indeed. do yourself a favor and start with the rib, then transfer to the main bed and beep on knitting.</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><blockquote><blockquote>" pride always brings along the less welcome humbling guest of the fall from grace."</blockquote></blockquote></div></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>neki desu</div><div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2022/01/this-too.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-4443040176723671863Wed, 12 Jan 2022 09:00:00 +00002022-01-12T10:00:00.225+01:00designneki desu futurible while the weather gets better<div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEjhe9w-UcsWl0utE158FuKRiL5N92HghkcHWJmwPodwxINDKKr6KlONwLnh7emOb3VbHrdOuzIstnFjwcYGABHJfRB3KTsqzHHVwJl4BIuVdOQyT1kROYUIfAuCCKllJbTbt0ZZJ0fMGri-Ayv1pH-2EATR92MbULDg6Uske9Iqv6eUiFt6lg=s700" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="525" data-original-width="700" height="480" src="https://blogger.googleusercontent.com/img/a/AVvXsEjhe9w-UcsWl0utE158FuKRiL5N92HghkcHWJmwPodwxINDKKr6KlONwLnh7emOb3VbHrdOuzIstnFjwcYGABHJfRB3KTsqzHHVwJl4BIuVdOQyT1kROYUIfAuCCKllJbTbt0ZZJ0fMGri-Ayv1pH-2EATR92MbULDg6Uske9Iqv6eUiFt6lg=w640-h480" width="640" /></a></div><br /></div><div>i am going to work with this composition and all its possible variations&nbsp; as an exercise to get back into ..whatever. every day for half an hour and let's see how it goes. will be posting the outcome<div class="separator" style="clear: both; text-align: right;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEjgqlepKkAWpNgvZ5gyFAcqWJRc7yj3s6---6sYIBTvrnIrSW0NCAdJJi9Tv_YD6NO8iRUggdDJCeoMmqYc-j1G46qyPXeXGiqeJkRGwe2Ls6DtlPTaGhEIu1Df55Xdxk0sjDLs14SKh_aJz55X_II3_cKlHqA2lXIiDoWod6Fr4m1hpp1vMQ=s700" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="525" data-original-width="700" height="300" src="https://blogger.googleusercontent.com/img/a/AVvXsEjgqlepKkAWpNgvZ5gyFAcqWJRc7yj3s6---6sYIBTvrnIrSW0NCAdJJi9Tv_YD6NO8iRUggdDJCeoMmqYc-j1G46qyPXeXGiqeJkRGwe2Ls6DtlPTaGhEIu1Df55Xdxk0sjDLs14SKh_aJz55X_II3_cKlHqA2lXIiDoWod6Fr4m1hpp1vMQ=w400-h300" width="400" /><div><br /></div><div><br /></div><div><br /></div></a><div><a href="https://blogger.googleusercontent.com/img/a/AVvXsEjgqlepKkAWpNgvZ5gyFAcqWJRc7yj3s6---6sYIBTvrnIrSW0NCAdJJi9Tv_YD6NO8iRUggdDJCeoMmqYc-j1G46qyPXeXGiqeJkRGwe2Ls6DtlPTaGhEIu1Df55Xdxk0sjDLs14SKh_aJz55X_II3_cKlHqA2lXIiDoWod6Fr4m1hpp1vMQ=s700" style="margin-left: 1em; margin-right: 1em;"></a><div class="separator" style="clear: both; text-align: left;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEjDpjITQ5tnO2R00oaiiAmpFyyM9VFypBDrjTK1LcTfOiRcNzz7WE2rbuYuBIK7gI9cfz7CQqmcUMKySiZi5ExpT5B38paGP_adwzAHPtu_gLY1MZpij5owKxA7qHFfIhMmu-pr1nF5hgFvzWeZxeweWppbRP_Xdm_bJHrlrs17QIGl3ZjQLA=s700" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img border="0" data-original-height="525" data-original-width="700" height="300" src="https://blogger.googleusercontent.com/img/a/AVvXsEjDpjITQ5tnO2R00oaiiAmpFyyM9VFypBDrjTK1LcTfOiRcNzz7WE2rbuYuBIK7gI9cfz7CQqmcUMKySiZi5ExpT5B38paGP_adwzAHPtu_gLY1MZpij5owKxA7qHFfIhMmu-pr1nF5hgFvzWeZxeweWppbRP_Xdm_bJHrlrs17QIGl3ZjQLA=w400-h300" width="400" /></a><a href="https://blogger.googleusercontent.com/img/a/AVvXsEjgqlepKkAWpNgvZ5gyFAcqWJRc7yj3s6---6sYIBTvrnIrSW0NCAdJJi9Tv_YD6NO8iRUggdDJCeoMmqYc-j1G46qyPXeXGiqeJkRGwe2Ls6DtlPTaGhEIu1Df55Xdxk0sjDLs14SKh_aJz55X_II3_cKlHqA2lXIiDoWod6Fr4m1hpp1vMQ=s700" style="margin-left: 1em; margin-right: 1em;"></a></div><br /></div><div><br /></div>also found these<i style="font-weight: bold;"> notes </i>that are worth exploring. maybe printed fabric? all those samples could be put to work.<br /><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>neki desu&nbsp;</div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2022/01/futurible-while-weather-gets-better.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-4668327627626930751Tue, 11 Jan 2022 09:00:00 +00002022-01-11T10:00:00.236+01:00neki desusewingunfolding<div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEiz9UoehEIH1b8L7AYN5Ftn-so2ozljz6VDYWzRzOchTHIlQD6yC-49ZGMjh3dVANoKSk7i2g0Iz0W7LMay4tpi-JX29bluuowKRQVNSpqUPa3M3qeNSXDo3UB1emxw8j3qnqHd5wUIH-p7hb54XiGCEbxwIOXuDXUH6MX9owkOe2MC6YmRfA=s700" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="525" data-original-width="700" height="480" src="https://blogger.googleusercontent.com/img/a/AVvXsEiz9UoehEIH1b8L7AYN5Ftn-so2ozljz6VDYWzRzOchTHIlQD6yC-49ZGMjh3dVANoKSk7i2g0Iz0W7LMay4tpi-JX29bluuowKRQVNSpqUPa3M3qeNSXDo3UB1emxw8j3qnqHd5wUIH-p7hb54XiGCEbxwIOXuDXUH6MX9owkOe2MC6YmRfA=w640-h480" width="640" /></a></div><br /></div><div>new project, although questioning the utility of it all. fabric bought in helsinki before we got into this absurd loop.</div><div>wool lined with cotton to prevent itchiness and ruined hosiery will make a pair of great pants with its corresponding topshirt.&nbsp;</div><div>it's going to take time bcse the japanese paterns to be used need to be traced and seam allowance added.</div><div><b>⋋__⋌&nbsp;&nbsp;</b></div><div><br /></div><div><br /></div><div>neki desu&nbsp;</div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; &nbsp;&nbsp;</div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2022/01/unfolding.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-6532384626068256919Mon, 10 Jan 2022 09:00:00 +00002022-01-10T10:00:00.389+01:00japanophilialife in generalneki desusurvivor<div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEgJ6Pv36C-HQYIDKNcDKXYmUY76bCvqSXEIEhHvrGIhvGza7VtOw2_jzGvLxeQafXZHusfD24eT2Z3NSHSC9tX6QM6gS5r0O0PMmDos-ITrFm-10osRhcC60ibi7M6Aq3OB2uiw4AN9CjHY2VHc2KBGvLU00eaHsv0QrV8eKr1rxu8Zen4PSA=s700" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="700" data-original-width="700" height="640" src="https://blogger.googleusercontent.com/img/a/AVvXsEgJ6Pv36C-HQYIDKNcDKXYmUY76bCvqSXEIEhHvrGIhvGza7VtOw2_jzGvLxeQafXZHusfD24eT2Z3NSHSC9tX6QM6gS5r0O0PMmDos-ITrFm-10osRhcC60ibi7M6Aq3OB2uiw4AN9CjHY2VHc2KBGvLU00eaHsv0QrV8eKr1rxu8Zen4PSA=w640-h640" width="640" /></a></div>watched a LOT and i mean a lot of j dramas in order to cope with the general lack of xmas spunk.</div><div>&nbsp;a selection of japanese ikemen who made it possible. eye candy is that place to go when the surroundings are bleak.</div><div>i realized that i was a real<a href="https://en.wikipedia.org/wiki/Hikikomori"><b> hikikomori</b></a>&nbsp; during my last 15 years in barcelona when i moved here. my contacts were through the net and had very little actual social contact.</div><div>just hikikomori not a hoarder.<b>(*▽*)</b></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>neki desu&nbsp;</div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2022/01/survivor.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-8420759826305244648Mon, 20 Dec 2021 15:58:00 +00002021-12-20T16:58:49.829+01:00animationneki desuwishes<div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEg0XbZDyydYKeyRQegR9fCHakHBBM_MrKu_xwPowSvB_uviU7ABieCPRwL4oBX41ImIlBv9hN-TZaEUG4o2cjpY2EzCSXpZV7pTj4WK1Sof-LmJK8DmBnkcdbj_FvPtB51E-ZDKrVbme5cWnJ1Etlpmui9yqhiI6E-lJAqdZ5sW2coDfxpkGA=s393" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="393" data-original-width="389" height="320" src="https://blogger.googleusercontent.com/img/a/AVvXsEg0XbZDyydYKeyRQegR9fCHakHBBM_MrKu_xwPowSvB_uviU7ABieCPRwL4oBX41ImIlBv9hN-TZaEUG4o2cjpY2EzCSXpZV7pTj4WK1Sof-LmJK8DmBnkcdbj_FvPtB51E-ZDKrVbme5cWnJ1Etlpmui9yqhiI6E-lJAqdZ5sW2coDfxpkGA=s320" width="317" /></a></div><br /></div><div><br /></div><div><br /></div><div>may you get all the good you deserve.</div><div>see you after epiphany. be well and be good</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><br />neki desu<div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2021/12/wishes.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-7958041313786744153Fri, 10 Dec 2021 09:00:00 +00002021-12-10T10:00:00.209+01:00japanophilianeki desuvidsnight fall<div style="text-align: center;"><iframe allow="autoplay; fullscreen; picture-in-picture" allowfullscreen="" frameborder="0" height="480" src="https://player.vimeo.com/video/90632143?h=8673b569f7&amp;color=ffffff" width="640"></iframe></div><div><br /></div><div><br /></div><div>serene and beautiful</div><div>have a good weekend</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div>neki desu&nbsp;<div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2021/12/night-fall.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-1609779780218631909Wed, 08 Dec 2021 09:00:00 +00002021-12-08T10:00:00.231+01:00machine knittingneki desuit's wearable<div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEjMx-L5TjXoxWn3X96izHYPtEf05sxYSt8YFnOgAbbPw-Qkzgf7uYQa6iGLeqHCfGIby5XgyCaPvHwad1vbzxQe96I-kWktH9ZHNghYJie8v_91m89TwXa57HXIc0gX2CSwKTQMtuGHmXw4xk6w2zc-YzdboijeiuBE613-757T9hYvPL-stg=s700" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="598" data-original-width="700" height="546" src="https://blogger.googleusercontent.com/img/a/AVvXsEjMx-L5TjXoxWn3X96izHYPtEf05sxYSt8YFnOgAbbPw-Qkzgf7uYQa6iGLeqHCfGIby5XgyCaPvHwad1vbzxQe96I-kWktH9ZHNghYJie8v_91m89TwXa57HXIc0gX2CSwKTQMtuGHmXw4xk6w2zc-YzdboijeiuBE613-757T9hYvPL-stg=w640-h546" width="640" /></a></div><br /></div><div>geez didn't it take time! sleeves became cut and sew, but the body was shaped on the machine.</div><div>sleeves are a different pattern giving the number some spark.( still have to hem them)</div><div><br /></div><div><br /></div><div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEhf9Q3GaoqgKl2jdMusA8jS0-P8WwEq76mIe8J7WgxVU7HM1y4-8yzW0ykPH6f5pDdq5f1d6Dq84mrOwwDlCuVYpkmAaTmANsUUq6D71R9qOWCH4C-bMrymCPuhaYosKN-NjFHGJc7-bq0qPnS5Sx6_MAmOpQnUKARBNaNGDJQranHqhtHeHA=s700" imageanchor="1" style="clear: right; float: right; margin-bottom: 1em; margin-left: 1em;"><img border="0" data-original-height="526" data-original-width="700" height="300" src="https://blogger.googleusercontent.com/img/a/AVvXsEhf9Q3GaoqgKl2jdMusA8jS0-P8WwEq76mIe8J7WgxVU7HM1y4-8yzW0ykPH6f5pDdq5f1d6Dq84mrOwwDlCuVYpkmAaTmANsUUq6D71R9qOWCH4C-bMrymCPuhaYosKN-NjFHGJc7-bq0qPnS5Sx6_MAmOpQnUKARBNaNGDJQranHqhtHeHA=w400-h300" width="400" /></a></div><br /></div><div>&nbsp;</div><div><br /></div><div><br /></div><div><br /></div><div>good craftsmanship: matching stripes at the shoulders.</div><div><br /></div><br /><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEgAJYlhvVnOw2dpoqvgMr_iESxONx46Pk-J0Q59rEXrxm0rKhepnEcy7mmwSk9N3hfp2Gvpq4mHi5ziNdaYqlevtUj9Qualb5xans49MqSAiQuN5-AFLrk6Nr_OKsmLiu_wJRG7cofHAvTKSWZ6bGsXrEJ3ZFwtWlbKSsOa58K-pkMhWrVPmQ=s700" imageanchor="1" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img border="0" data-original-height="526" data-original-width="700" height="300" src="https://blogger.googleusercontent.com/img/a/AVvXsEgAJYlhvVnOw2dpoqvgMr_iESxONx46Pk-J0Q59rEXrxm0rKhepnEcy7mmwSk9N3hfp2Gvpq4mHi5ziNdaYqlevtUj9Qualb5xans49MqSAiQuN5-AFLrk6Nr_OKsmLiu_wJRG7cofHAvTKSWZ6bGsXrEJ3ZFwtWlbKSsOa58K-pkMhWrVPmQ=w400-h300" width="400" /></a></div><br /><div><br /></div><div><br /></div><div><br /></div><div>the agar agar issue.it worked really well to hold and pick up the stitches, but was a royal pain in the butt to wash off. still some showing but counting on its rubbing off since it's the back.</div><div><br /></div><div>this pattern is going to be a repeat.</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><br /><br /><div><br /></div><div><br /></div><div>neki desu&nbsp;</div><div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2021/12/its-wearable.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-8770714887496977113Tue, 07 Dec 2021 09:00:00 +00002021-12-07T10:00:00.213+01:00neki desutaberucake pandemonium<div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEjrwxTQHWnNI-9EzNyZ6zhEAc-vwANzCksB2qN2nPW3bqmz6mEoAPufddZZYrynw6nCcRkeHiaFls9aGGoxTHmH5R0RjP5HMk3sTcUGiXCGryJlOpH2hqwlKShjJ8aW6Gg5BXx9LH4f57r1R8X3P_Rg_0qffUf94c9Ri-wFpW8OB0sNZF02xg=s700" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="700" data-original-width="526" height="400" src="https://blogger.googleusercontent.com/img/a/AVvXsEjrwxTQHWnNI-9EzNyZ6zhEAc-vwANzCksB2qN2nPW3bqmz6mEoAPufddZZYrynw6nCcRkeHiaFls9aGGoxTHmH5R0RjP5HMk3sTcUGiXCGryJlOpH2hqwlKShjJ8aW6Gg5BXx9LH4f57r1R8X3P_Rg_0qffUf94c9Ri-wFpW8OB0sNZF02xg=w300-h400" width="300" /></a></div><br /><div><br /></div><div><br /></div><div>this year we're late due to the trip, much needed on the other hand.it takes longer to get back in the swing of things. but anyway here we go. every year i am in a state of awe at how i managed in my tiny barcelona kitchen. of course that meant no helper. this has become a no stress event with wine and music to work by.</div><div><br /></div><div><br /></div><div><br /><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEh6Sfmly94l-4vkv6WsUjiSF7V_L4ixaHOv2aR1oZTLnJ4ItueLjVtc9eVWz6ivHKbDfHozQqp5Z-P4xhoSgY_NY4hYWhrzaAQJz8zRbsUznAq6mM26C9bLpWiBupn-RrqaHXako8sqw-oXlSK7VZQ571LJiBqA409TJL7zn9icdbDfedVMwA=s700" imageanchor="1" style="clear: right; float: right; margin-bottom: 1em; margin-left: 1em;"><img border="0" data-original-height="700" data-original-width="526" height="400" src="https://blogger.googleusercontent.com/img/a/AVvXsEh6Sfmly94l-4vkv6WsUjiSF7V_L4ixaHOv2aR1oZTLnJ4ItueLjVtc9eVWz6ivHKbDfHozQqp5Z-P4xhoSgY_NY4hYWhrzaAQJz8zRbsUznAq6mM26C9bLpWiBupn-RrqaHXako8sqw-oXlSK7VZQ571LJiBqA409TJL7zn9icdbDfedVMwA=w300-h400" width="300" /></a></div></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>&nbsp;still have some yuzu left from the last trip to japan.</div><div>let's see if they let me in&nbsp; to buy some more.</div><div>cakes are already curing in brandy.</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>neki desu&nbsp;</div><div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2021/12/cake-pandemonium.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-5594892481103419595Mon, 06 Dec 2021 09:00:00 +00002021-12-06T10:00:00.274+01:00life in generalneki desuportotravelsall aspects of time<div><a href="https://amovablefeast.blogspot.com/2006/08/oh-porto-vila-nova-de-gaia.html"><b>&nbsp;16 years ago</b></a></div><div><br /></div><div><br /></div><div><br /><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEjMBSKD--vc1bKl5khL3fxqPKIJfDe0-JhI-t0Tg9vNY9V1UKfoJgLOHlLQzXIeWfLtalfMcDYeP6BFIzMny0eOe323WNDSDsWky2sKPfU3h1vav70dLm2XT942s1lp_GPFoFgIbV0aRKA4TjFRFYrToFzX6zn5rrHpXGhfSHYFp3EHSPI8bA=s700" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="700" data-original-width="382" height="400" src="https://blogger.googleusercontent.com/img/a/AVvXsEjMBSKD--vc1bKl5khL3fxqPKIJfDe0-JhI-t0Tg9vNY9V1UKfoJgLOHlLQzXIeWfLtalfMcDYeP6BFIzMny0eOe323WNDSDsWky2sKPfU3h1vav70dLm2XT942s1lp_GPFoFgIbV0aRKA4TjFRFYrToFzX6zn5rrHpXGhfSHYFp3EHSPI8bA=w219-h400" width="219" /></a></div></div><div><br /></div><div><br /></div><div>same photo with some more years, kilos and a pandemic mask.sigh. same for the city which is showing the&nbsp; signs of gentrification aka loss of charm.&nbsp;<b>(╯︵╰,)</b></div><div><br /></div><div style="text-align: center;"><br /></div><div style="text-align: center;"><br /></div><div style="text-align: center;">old friends</div><div style="text-align: center;"><br /></div><div><a href="https://blogger.googleusercontent.com/img/a/AVvXsEi9AQHin3ZhsUHevnOgrABtGRFA1mGoBRG5Wqo72EdDiJN417Yv5y8M6uaHTs3knVP9seDEuU1G4Yatdo-T7bi8hkBMC6b3teuNy9yiYZV9Yp2I-Q7bIHkuBY2MJwA2NHPmoIduvFtoy7fSBQafTeF27QLh0X3PFRx-DNVNb5Q-mi4pIJl03g=s700" style="clear: right; display: block; float: right; margin-bottom: 1em; margin-left: 1em; padding: 1em 0px; text-align: center;"><img alt="" border="0" data-original-height="700" data-original-width="352" height="320" src="https://blogger.googleusercontent.com/img/a/AVvXsEi9AQHin3ZhsUHevnOgrABtGRFA1mGoBRG5Wqo72EdDiJN417Yv5y8M6uaHTs3knVP9seDEuU1G4Yatdo-T7bi8hkBMC6b3teuNy9yiYZV9Yp2I-Q7bIHkuBY2MJwA2NHPmoIduvFtoy7fSBQafTeF27QLh0X3PFRx-DNVNb5Q-mi4pIJl03g=s320" /></a><br /></div><div><a href="https://blogger.googleusercontent.com/img/a/AVvXsEj8s54xAQp3S4TmyiCLpwQOGdVDZPD9sCs5sxCEk9lis0UwLtQSJyRmO5L9olJieWgD6x9opyh0nhmWm6xcla7zCoT6-fhKVwYzWin22cMCpKyI61-auAg5_wo4gp2h9szN_KOYGSlu1Eju4TyeOxAzBDMH9xE3jkpe9QW0k-YpggXB5I7b_g=s700" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img border="0" data-original-height="700" data-original-width="315" height="320" src="https://blogger.googleusercontent.com/img/a/AVvXsEj8s54xAQp3S4TmyiCLpwQOGdVDZPD9sCs5sxCEk9lis0UwLtQSJyRmO5L9olJieWgD6x9opyh0nhmWm6xcla7zCoT6-fhKVwYzWin22cMCpKyI61-auAg5_wo4gp2h9szN_KOYGSlu1Eju4TyeOxAzBDMH9xE3jkpe9QW0k-YpggXB5I7b_g=s320" width="144" /></a><br /></div><div><div class="separator" style="clear: both; text-align: center;"><div class="separator" style="clear: both;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEj8s54xAQp3S4TmyiCLpwQOGdVDZPD9sCs5sxCEk9lis0UwLtQSJyRmO5L9olJieWgD6x9opyh0nhmWm6xcla7zCoT6-fhKVwYzWin22cMCpKyI61-auAg5_wo4gp2h9szN_KOYGSlu1Eju4TyeOxAzBDMH9xE3jkpe9QW0k-YpggXB5I7b_g=s700" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"></a></div><div class="separator" style="clear: both; text-align: left;">egregia do carmo&nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp;</div><div class="separator" style="clear: both; text-align: right;"><span style="text-align: center;">new friends&nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp;&nbsp;</span>&nbsp;&nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; &nbsp; shop</div><div class="separator" style="clear: both; text-align: center;">&nbsp;</div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEgbCRcP3A0myTRFGFkrhK3bPLb-VE6AYVaQ4-mUGq6UMFPtrrJ9mD01e6p_1Q7cz21zmgiYnaDfq5totqXfIndJVAZKBo_M6HXSSQna9UE5gWnBEytQ7LhUfqRcY0_LCR4W1VHuY2JOTErKsY-b3tvB71MOaAgenCpZ4hghh9r0m-AG9GkfPA=s700" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="325" data-original-width="700" height="149" src="https://blogger.googleusercontent.com/img/a/AVvXsEgbCRcP3A0myTRFGFkrhK3bPLb-VE6AYVaQ4-mUGq6UMFPtrrJ9mD01e6p_1Q7cz21zmgiYnaDfq5totqXfIndJVAZKBo_M6HXSSQna9UE5gWnBEytQ7LhUfqRcY0_LCR4W1VHuY2JOTErKsY-b3tvB71MOaAgenCpZ4hghh9r0m-AG9GkfPA=s320" width="320" /></a></div><br /><div class="separator" style="clear: both; text-align: center;">mural&nbsp; by joana vasconcelos</div><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: left;">and the douro</div><div class="separator" style="clear: both; text-align: center;"><a href="https://blogger.googleusercontent.com/img/a/AVvXsEiUHeFQLRBTlyJuOR9N_MGxXkbF0TcICoRpfbnF5sNEgiBIPKWpDpSUcnzCpaku0KFRYskVEx9sDpWTUK8O6k38GjPRwt_1i8nI79iPI25Fp1OifpcTD0TfgMnbMre10fgywQAyIAA4ujbboJ8RmOF2crbm1Dram0ltDh6VffTWoWQq2Lwj-Q=s700" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="700" data-original-width="565" height="400" src="https://blogger.googleusercontent.com/img/a/AVvXsEiUHeFQLRBTlyJuOR9N_MGxXkbF0TcICoRpfbnF5sNEgiBIPKWpDpSUcnzCpaku0KFRYskVEx9sDpWTUK8O6k38GjPRwt_1i8nI79iPI25Fp1OifpcTD0TfgMnbMre10fgywQAyIAA4ujbboJ8RmOF2crbm1Dram0ltDh6VffTWoWQq2Lwj-Q=w323-h400" width="323" /></a></div><br /><div class="separator" style="clear: both; text-align: left;"><br /></div><div class="separator" style="clear: both; text-align: left;">in all its twilight magnificence.</div><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;"><br /></div><div class="separator" style="clear: both; text-align: center;"><br /></div><div style="text-align: left;">neki desu</div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em; text-align: left;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a><div style="text-align: left;">&nbsp;</div></div></div></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2021/12/all-aspects-of-time.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-8922305794598219555Wed, 03 Nov 2021 09:00:00 +00002021-11-03T10:00:00.237+01:00neki desuvids. portugaland with this my friends<iframe allow="accelerometer; autoplay; clipboard-write; encrypted-media; gyroscope; picture-in-picture" allowfullscreen="" frameborder="0" height="480" src="https://www.youtube.com/embed/vMi8gG2QAyk" title="YouTube video player" width="640"></iframe> <div><br /></div><div><br /></div><div>i'm taking a leave. my first post confinement trip to my much loved porto.</div><div>see you in a fortnight give or take.&nbsp;</div><div>&nbsp;photos on insta.</div><div>be well and be good</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>neki desu</div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2021/11/and-with-this-my-friends.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-335059846827042112Tue, 02 Nov 2021 09:00:00 +00002021-11-02T10:00:00.243+01:00card punchingmachine knittingneki desusuch a crack up<div><br /></div><div class="separator" style="clear: both; text-align: center;"><a href="https://1.bp.blogspot.com/-Ec9HsjTn5Z4/YX68sjQpIZI/AAAAAAAAG9E/WBXLLNzy_akLPoyp4GI1w6-96afTLbuUACLcBGAsYHQ/s700/intensive.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="526" data-original-width="700" height="480" src="https://1.bp.blogspot.com/-Ec9HsjTn5Z4/YX68sjQpIZI/AAAAAAAAG9E/WBXLLNzy_akLPoyp4GI1w6-96afTLbuUACLcBGAsYHQ/w640-h480/intensive.jpg" width="640" /></a></div><br /><div><br /></div><div>when people say machine knitting is cheating and not valid as handmade.since iv'e already dealt with that narrow mindness re cad weaving i am not wasting time replying or educating. i have come to find such ignorance&nbsp; amusing.&nbsp;</div><div>people have not encountered doing the last row and hearing a thud when the knitting gracefully drops from the machine and ends on the floor.</div><div>neither punching cards and getting the binary code glitchy therefore knitting imperfectly at&nbsp; best.</div><div><br /></div><div>punching a card for the next project, on stash busting mode.</div><div>it is quite vexing to find books which do not explain the ins and outs of punching cards and just limit themselves to images of cards and results. some are not so terrible as they consider there are different brands of machines which read cards in different ways.</div><div>luckily for m knitters there's alessandrina's blog where all the wisdom of the craft is deposited.</div><div>i use it as my repository where all my questions are answered or clarified.</div><div>re punch cards <b><a href="https://alessandrina.com/2015/09/03/brother-kms-punchcards-and-their-use/">here's</a></b> the definitive guide. you're welcome&nbsp;</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div>neki desu<div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2021/11/such-crack-up.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-5363104211576271371Mon, 01 Nov 2021 09:00:00 +00002021-11-01T10:00:00.235+01:00machine knittingneki desufront,back and back again<div><div class="separator" style="clear: both; text-align: center;"><a href="https://1.bp.blogspot.com/-CQTG_Y1ARyc/YX63TDbof0I/AAAAAAAAG8s/MX7SOdrxG2oRWmrqJWKVr4qymOnVKo_TACLcBGAsYHQ/s700/back.jpg" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="656" data-original-width="700" height="600" src="https://1.bp.blogspot.com/-CQTG_Y1ARyc/YX63TDbof0I/AAAAAAAAG8s/MX7SOdrxG2oRWmrqJWKVr4qymOnVKo_TACLcBGAsYHQ/w640-h600/back.jpg" width="640" /></a></div><br /></div><div>front and back are exactly alike,but while the front knitted&nbsp; fast and with no misfortune,the back was a major incubus. three times it was knitted to a continuous sense of aggravation. the last time all kinds of measures were taken</div><div><br /></div><div class="separator" style="clear: both; text-align: center;"><a href="https://1.bp.blogspot.com/-TLvcmntMUZc/YX648lbTihI/AAAAAAAAG80/ScIBoyAajGoCbUA2J7uwJPcjPXIgCtLngCLcBGAsYHQ/s700/agar.jpg" style="clear: right; float: right; margin-bottom: 1em; margin-left: 1em;"><img border="0" data-original-height="526" data-original-width="700" height="240" src="https://1.bp.blogspot.com/-TLvcmntMUZc/YX648lbTihI/AAAAAAAAG80/ScIBoyAajGoCbUA2J7uwJPcjPXIgCtLngCLcBGAsYHQ/s320/agar.jpg" width="320" /></a></div>&nbsp;agar aga was painted on and the portion above was undone, then the stitches were picked up to continue with the knitting.time intensive ,but sdtarting from scratch again was not on the agenda.especially after such character building episodes.<br /><div><br /></div><br /><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div class="separator" style="clear: both; text-align: center;"><a href="https://1.bp.blogspot.com/-CmPrx1Xbt4M/YX65sZbj9hI/AAAAAAAAG88/A4pwqRNjf-UWNXV51iOR6iik99Yk4vg5gCLcBGAsYHQ/s700/lifeline.jpg" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img border="0" data-original-height="526" data-original-width="700" height="240" src="https://1.bp.blogspot.com/-CmPrx1Xbt4M/YX65sZbj9hI/AAAAAAAAG88/A4pwqRNjf-UWNXV51iOR6iik99Yk4vg5gCLcBGAsYHQ/s320/lifeline.jpg" width="320" /></a></div>&nbsp;then a lifeline was added at the end to minimize risk of skipping stitches while&nbsp; using the gatepeg bindoff<br /><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>all in all it worked and now the infamous back is blocking and drying, another thing will be getting rid of the agar agar.but that's another story. now it needs to be joined from the funnel neck down to the shoulder. a pattern for cut and sew sleeves&nbsp; needs to be drafted. using 2 already knitted lenghts same 2 colors different pattern, experiments in funkiness'.<b> ( ̄︶ ̄)</b></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>neki desu&nbsp;</div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2021/11/frontback-and-back-again.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-1019465545993991171Fri, 15 Oct 2021 08:00:00 +00002021-10-15T10:00:00.220+02:00fashionjapanophilianeki desuvidsthis might not be everyone's cup of tea<iframe width="640" height=480" src="https://www.youtube.com/embed/BxpEt1qfXOg?controls=0" title="YouTube video player" frameborder="0" allow="accelerometer; autoplay; clipboard-write; encrypted-media; gyroscope; picture-in-picture" allowfullscreen></iframe> <div><br /></div><div><br /></div><div>but conceded, it is interesting,</div><div>have a good weekend</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>neki desu</div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2021/10/this-might-not-be-everyones-cup-of-tea.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-3554597174893513778Thu, 14 Oct 2021 08:00:00 +00002021-10-14T10:00:00.234+02:00dbjmachine knittingneki desuoort 😉<div><br /></div><div><div class="separator" style="clear: both; text-align: center;"><a href="https://1.bp.blogspot.com/-bETDIymMJ7I/YWMTpmALONI/AAAAAAAAG8I/6PhXzzujAT0up87V_s31aSX7cYlyX758wCLcBGAsYHQ/s700/shibu.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="526" data-original-width="700" height="480" src="https://1.bp.blogspot.com/-bETDIymMJ7I/YWMTpmALONI/AAAAAAAAG8I/6PhXzzujAT0up87V_s31aSX7cYlyX758wCLcBGAsYHQ/w640-h480/shibu.jpg" width="640" /></a></div><br /></div><div><br /></div><br /><div><br /></div><div>relatively pleased. it has been painful knitting due to some rows with no pixel. this means that the machine reads it as a free pass and the sequence of colors gets wonky affecting the image.</div><div>after many,many tries found that was the problem and could correct it.this one knitted ok with some bunched yarn errors. the bottom part is the hem and won't show,so is the red stripe at the top.</div><div>will keep at it. after all this is a series of 4.</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>neki desu&nbsp;</div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2021/10/oort.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-1984697014348984177Wed, 13 Oct 2021 08:00:00 +00002021-10-13T10:00:00.285+02:00japanophilianeki desuanother labor of patience<div><div class="separator" style="clear: both; text-align: center;"><a href="https://1.bp.blogspot.com/-5_AK6Y5K9fc/YWMgb5QiExI/AAAAAAAAG8Q/AqGosB8BwIAJ6_kDHMRlkTUglQDg47dDwCLcBGAsYHQ/s700/nara%2Bink.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="526" data-original-width="700" height="480" src="https://1.bp.blogspot.com/-5_AK6Y5K9fc/YWMgb5QiExI/AAAAAAAAG8Q/AqGosB8BwIAJ6_kDHMRlkTUglQDg47dDwCLcBGAsYHQ/w640-h480/nara%2Bink.jpg" width="640" /></a></div><br /></div><div><br /></div><div>making ink. the nice ultra black one. using an inkstick i bought at a venerable ink/brush/paper shop in nara in 2018. was keeping it but the alternative of being buried with it sounded rather dumb.</div><div>&nbsp;it takes time and some elbow grease, but the process is meditative, the outcome is brilliant.</div><div><br /></div><div><br /></div><div><br /></div><div>neki desu</div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2021/10/another-labor-of-patience.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-7859257656535698080Tue, 12 Oct 2021 08:00:00 +00002021-10-12T10:00:00.270+02:00machine knittingneki desufall wardrobe<div><div class="separator" style="clear: both; text-align: center;"><a href="https://1.bp.blogspot.com/-KkR-1xG8JGA/YWMQqvdY_VI/AAAAAAAAG74/6iXGO19n2ToAMXSQasdnYxkX5UK1coK7QCLcBGAsYHQ/s700/stripes.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="526" data-original-width="700" height="480" src="https://1.bp.blogspot.com/-KkR-1xG8JGA/YWMQqvdY_VI/AAAAAAAAG74/6iXGO19n2ToAMXSQasdnYxkX5UK1coK7QCLcBGAsYHQ/w640-h480/stripes.jpg" width="640" /></a></div><br /></div><div><br /></div><div><br /></div><div>a striped number, but thinking about adding some jazz to it, maybe the sleeves in a 2 color tuck?<br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /><div class="separator" style="clear: both; text-align: center;"><a href="https://1.bp.blogspot.com/-HM6N9N7Hs_A/YWMSsUUVd-I/AAAAAAAAG8A/yqCHUazuYMMBlc3maShQBk6-KKvSmVH8QCLcBGAsYHQ/s1198/sweater.PNG" imageanchor="1" style="clear: right; float: right; margin-bottom: 1em; margin-left: 1em;"><img border="0" data-original-height="887" data-original-width="1198" height="296" src="https://1.bp.blogspot.com/-HM6N9N7Hs_A/YWMSsUUVd-I/AAAAAAAAG8A/yqCHUazuYMMBlc3maShQBk6-KKvSmVH8QCLcBGAsYHQ/w400-h296/sweater.PNG" width="400" /></a></div></div><div style="text-align: justify;">very simple almost no brainer knitting.</div><div style="text-align: justify;">as long as it's drop shoulder&nbsp; i can swing it.</div><div style="text-align: justify;"><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><br /><br /><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div>neki desu&nbsp;<div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2021/10/fall-wardrobe.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-7810057607879330807Mon, 11 Oct 2021 08:00:00 +00002021-10-11T10:00:00.212+02:00life in generalnekidesua source of satisfaction<div><div class="separator" style="clear: both; text-align: center;"><a href="https://1.bp.blogspot.com/-_URstCIG9fQ/YWMAOq57TvI/AAAAAAAAG7I/iuUiR644vOsRtcUvMlng7Mwoj1lORb4mgCLcBGAsYHQ/s700/pink%2Bthread.jpg" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="538" data-original-width="700" height="492" src="https://1.bp.blogspot.com/-_URstCIG9fQ/YWMAOq57TvI/AAAAAAAAG7I/iuUiR644vOsRtcUvMlng7Mwoj1lORb4mgCLcBGAsYHQ/w640-h492/pink%2Bthread.jpg" width="640" /></a></div><br /></div><div><br /></div><div><br /></div><div>must be one of those age things, but i find immense satisfaction in detangling yarns.&nbsp;</div><div><br /></div><div><br /></div><div><div class="separator" style="clear: both; text-align: center;"><a href="https://1.bp.blogspot.com/-w6yCqS3905o/YWMAKWS4XNI/AAAAAAAAG7E/HX4GnySCOxYpAHteK1-hZG0FHr4P3N38ACLcBGAsYHQ/s700/grey%2Bthread.jpg" style="clear: right; float: right; margin-bottom: 1em; margin-left: 1em;"><img border="0" data-original-height="526" data-original-width="700" height="300" src="https://1.bp.blogspot.com/-w6yCqS3905o/YWMAKWS4XNI/AAAAAAAAG7E/HX4GnySCOxYpAHteK1-hZG0FHr4P3N38ACLcBGAsYHQ/w400-h300/grey%2Bthread.jpg" width="400" /></a></div><br /></div><div style="text-align: justify;">even silk&nbsp; which forms nests of tangles.</div><div style="text-align: justify;">cotton and wool are no brainers really; linen presents some uphill moments.</div><div>&nbsp;</div><div>speaking of uphill i have recently joined two citizen platforms that are contesting two public projects.</div><div>one,which directly affects our hood, is the building of a pavillion for fairs and other events in a beautiful area of fields and pastures. this will impact the traffic volume, will be ideal grounds for illegal macro raves&nbsp; with all the garbage, noise and vandalism that is bound to happen. it will also affect the brook&nbsp; &nbsp;polluting it with waste residues and garbage generated from the events.</div><div><br /></div><div>the other project will affect the city, but especially the surrounding hills to the north. there are talks to build a roundabout ring on the north side of town and this will affect all the natural surroundings&nbsp; including the totemic monte naranco&nbsp; with all the hiking trails, wildlife and romanesque monuments.</div><div>it will ruin a beautiful area and it won't solve the alleged traffic problems in the city. it will also shave off part of the walking tralis on the northeast and part of the park in the northwest. .</div><div>the whole thing is demented because the same political forces that are promoting asturias as a natural paradise, which it is (still) want to kill it.</div><div><br /></div><div>after being in survival mode for so long during the pandemic time for action&nbsp;has come&nbsp;.</div><div><br /></div><div><br /></div><div class="separator" style="clear: both; text-align: center;"><a href="https://1.bp.blogspot.com/-zQHtF9btBQY/YWMO7hj-3UI/AAAAAAAAG7Y/BrqEYKgrs9oc6yaZWIqlCTZLMRRdm6K7wCLcBGAsYHQ/s700/brook.jpg" imageanchor="1" style="margin-left: 1em; margin-right: 1em;"><img border="0" data-original-height="700" data-original-width="525" height="320" src="https://1.bp.blogspot.com/-zQHtF9btBQY/YWMO7hj-3UI/AAAAAAAAG7Y/BrqEYKgrs9oc6yaZWIqlCTZLMRRdm6K7wCLcBGAsYHQ/w240-h320/brook.jpg" width="240" /></a></div><br />&nbsp; &nbsp; &nbsp; &nbsp;<div><br /><div class="separator" style="clear: both; text-align: center;"><div class="separator" style="clear: both; text-align: center;"><a href="https://1.bp.blogspot.com/-GHOEhOM-p2E/YWMP5QW6isI/AAAAAAAAG7w/k24rCLf06W0mi1JzXyJQmUp1178FiTNeQCLcBGAsYHQ/s700/pura.jpg" imageanchor="1" style="clear: right; float: right; margin-bottom: 1em; margin-left: 1em;"><img border="0" data-original-height="700" data-original-width="544" height="320" src="https://1.bp.blogspot.com/-GHOEhOM-p2E/YWMP5QW6isI/AAAAAAAAG7w/k24rCLf06W0mi1JzXyJQmUp1178FiTNeQCLcBGAsYHQ/s320/pura.jpg" width="249" /></a></div><br /><a href="https://1.bp.blogspot.com/-9j49ZR1CgYc/YWMPBcfkeDI/AAAAAAAAG7g/E05MH_WL9BklrBFudcbwdygyY2MDEeR_wCLcBGAsYHQ/s700/valley.jpg" imageanchor="1" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img border="0" data-original-height="700" data-original-width="516" height="320" src="https://1.bp.blogspot.com/-9j49ZR1CgYc/YWMPBcfkeDI/AAAAAAAAG7g/E05MH_WL9BklrBFudcbwdygyY2MDEeR_wCLcBGAsYHQ/s320/valley.jpg" width="236" /></a></div><br /><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><span style="text-align: left;"><span>&nbsp;</span></span></div><div><span style="text-align: left;"><br /></span></div><div><span style="text-align: left;"><br /></span></div><div><span style="text-align: left;"><br /></span></div><div><span style="text-align: left;"><br /></span></div><div><span style="text-align: left;"><br /></span></div><div><span style="text-align: left;"><br /></span></div><div><span style="text-align: left;"><br /></span></div><div>&nbsp;say goodbye to this?</div><div><span style="text-align: left;"><br /></span></div><div><span style="text-align: left;">neki desu&nbsp;</span></div><div><div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div></div></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2021/10/a-source-of-satisfaction.htmlnoreply@blogger.com (neki desu)0tag:blogger.com,1999:blog-17256618.post-6456092145131058622Thu, 30 Sep 2021 08:00:00 +00002021-09-30T10:00:00.217+02:00balenciagafashionneki desuvidsnever ending admiration<div style="text-align: center;"><iframe allow="autoplay; fullscreen; picture-in-picture" allowfullscreen="" frameborder="0" height="480" src="https://player.vimeo.com/video/229921308?h=ea6ff0fdb0" width="640"></iframe></div> <div><br /></div><div><br /></div><div>for the master.</div><div>have a good weekend.</div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div><div><br /></div>neki desu<div><a href="http://creativecommons.org/licenses/by-nc-sa/4.0/" rel="license" style="clear: left; float: left; margin-bottom: 1em; margin-right: 1em;"><img alt="Creative Commons License" src="https://i.creativecommons.org/l/by-nc-sa/4.0/80x15.png" style="border-width: 0px;" /></a>&nbsp; <br /></div><div class="blogger-post-footer">neki desu at a movable feast This work is licensed under a <a rel="license" href="http://creativecommons.org/licenses/by-nc-sa/4.0/">Creative Commons Attribution-NonCommercial-ShareAlike 4.0 International License</a>.</div>https://amovablefeast.blogspot.com/2021/09/never-ending-admiration.htmlnoreply@blogger.com (neki desu)0